Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0379300_circ_g.2 |
| ID in PlantcircBase | osa_circ_023564 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 18524429-18524823 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os04g0379300 |
| Parent gene annotation |
Methyltransferase type 11 domain containing protein. (Os04t03793 00-01);Similar to predicted protein. (Os04t0379300-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os04t0379300-01:3 Os04t0379300-02:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.236965042 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
18524511-18524504(+) 18524642-18524439(+) 18524658-18524780(-) 18524442-18524780(-) |
| Potential amino acid sequence |
MVFLDSRHANADMDVIKNDLSPLVKDLEPGNPEEEARIPFEHMNGFLLQKKDSGMLLKVQRLLV *(+) MQMLTWMLSRMIYLPLLRIWNLEILKRKLVYRSST*(+) MSAFACLLSKNTIIRRAAFALSTTCHCPSSEAKSHSCARTVYELPLQDFQVPDP*(-) MCSNGIRASSSGFPGSRSLTRGDKSFLITSMSAFACLLSKNTIIRRAAFALSTTCHCPSSEAKS HSCARTVYELPLQDFQVPDP*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |