Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os11g0648100_circ_g.2 |
| ID in PlantcircBase | osa_circ_009892 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr11: 25777547-25777711 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os11g0648100 |
| Parent gene annotation |
Kinesin, motor domain domain containing protein. (Os11t0648100-0 1) |
| Parent gene strand | - |
| Alternative splicing | Os11g0648100_circ_g.1 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os11t0648100-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.272620808 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
25777701-25777642(+) 25777657-25777697(-) |
| Potential amino acid sequence |
MLMIQCDRLETSLTFVQDVDRARRPLQYHWLAFLRS*(+) MLQFKTSRRPTSGTAEDGVHGRRLGQMLTMFRVDRIESSAY*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |