Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.003G053000_circ_g.1 |
| ID in PlantcircBase | gra_circ_000240 |
| Alias | Chr03:8089651|8091489 |
| Organism | Gossypium raimondii |
| Position | chrChr03: 8089651-8091489 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.003G053000 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.003G053000.1:4 Gorai.003G053000.10:4 Gorai.003G053000.7:4 Gorai.003G053000.6:4 Gorai.003G053000.5:4 Gorai.003G053000.3:4 Gorai.003G053000.12:4 Gorai.003G053000.8:4 Gorai.003G053000.11:4 Gorai.003G053000.4:4 Gorai.003G053000.2:4 Gorai.003G053000.9:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.10323462 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
8089678-8089673(+) 8091463-8089673(+) 8090461-8091456(-) |
| Potential amino acid sequence |
MGKGKIAAQCSHATLGLYKKLLHRAPKALNRWEMCAQPKERAKSLNIPTHITIDAGRTQIAPST GCKKRS*(+) MQGELRLHQVLVVRNDLKMGKGKIAAQCSHATLGLYKKLLHRAPKALNRWEMCAQPKERAKSLN IPTHITIDAGRTQIAPSTGCKKRS*(+) MTALGSNFPFTHLKIVSYNQYLVQSEFSLHQW*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |