Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT5G61270_circ_g.3 |
| ID in PlantcircBase | ath_circ_045173 |
| Alias | At_ciR1436 |
| Organism | Arabidpsis thaliana |
| Position | chr5: 24639691-24639795 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ, circseq_cup, CIRI-full |
| Parent gene | AT5G61270 |
| Parent gene annotation |
Transcription factor PIF7 |
| Parent gene strand | - |
| Alternative splicing | AT5G61270_circ_g.1 AT5G61270_circ_g.2 AT5G61270_circ_g.4 AT5G61270_circ_g.5 |
| Support reads | 25/4 |
| Tissues | leaf/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT5G61270.1:1 AT5G61270.2:1 AT5G61270.3:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.280997942 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
24639774-24639693(-) |
| Potential amino acid sequence |
MNKRQEEKQVDLMDDGDEQQRFTTSPKGKLKILKEMNKRQEEKQVDLMDDGDEQQRFTTSPKGK LKILKEMNKRQEEKQVDLMDDGDEQQRFTTSPKGKLKILKEMNKRQEEKQVDLMDDGDEQQRFT TSPK(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |