Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | BGIOSGA001195_circ_g.3 |
ID in PlantcircBase | osi_circ_002216 |
Alias | 1:27681063|27682440 |
Organism | Oryza sativa ssp. indica |
Position | chr1: 27681063-27682440 JBrowse» |
Reference genome | Oryza_indica.ASM465v1.42 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | BGIOSGA001195 |
Parent gene annotation | NA |
Parent gene strand | - |
Alternative splicing | BGIOSGA001195_circ_g.4 BGIOSGA001195_circ_g.5 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | BGIOSGA001195-TA:5 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
27682438-27682404(-) 27682359-27681078(+) |
Potential amino acid sequence |
MGAAALQKYIGSLGGIGASGVGSSSSYSPKELNKDIMPEKNVKTFKDVKGCDDAKKELEEVVEY LKNPSKFTRLGGKLPKGILLTGSPGTGKTLLAKAIAGEAGVPFFYRAGSEFEEMFVGVGARRVR SLFQAAKKKGNGCCCSSKVYW*(-) MMNWNQHQMPLFHLSYQYTFEEQQHPLPFFFAA*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Huang et al., 2021 |