Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | BGIOSGA001195_circ_g.3 |
| ID in PlantcircBase | osi_circ_002216 |
| Alias | 1:27681063|27682440 |
| Organism | Oryza sativa ssp. indica |
| Position | chr1: 27681063-27682440 JBrowse» |
| Reference genome | Oryza_indica.ASM465v1.42 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | BGIOSGA001195 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | BGIOSGA001195_circ_g.4 BGIOSGA001195_circ_g.5 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | BGIOSGA001195-TA:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
27682438-27682404(-) 27682359-27681078(+) |
| Potential amino acid sequence |
MGAAALQKYIGSLGGIGASGVGSSSSYSPKELNKDIMPEKNVKTFKDVKGCDDAKKELEEVVEY LKNPSKFTRLGGKLPKGILLTGSPGTGKTLLAKAIAGEAGVPFFYRAGSEFEEMFVGVGARRVR SLFQAAKKKGNGCCCSSKVYW*(-) MMNWNQHQMPLFHLSYQYTFEEQQHPLPFFFAA*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Huang et al., 2021 |