Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT5G18230_circ_g.11 |
| ID in PlantcircBase | ath_circ_038953 |
| Alias | AT5G18230_C2 |
| Organism | Arabidpsis thaliana |
| Position | chr5: 6024616-6025209 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder, circRNA_finder, CIRI2 |
| Parent gene | AT5G18230 |
| Parent gene annotation |
transcription regulator NOT2/NOT3/NOT5 family protein |
| Parent gene strand | - |
| Alternative splicing | AT5G18230_circ_g.5 AT5G18230_circ_g.6 AT5G18230_circ_g.7 AT5G18230_circ_g.8 AT5G18230_circ_g.9 AT5G18230_circ_g.10 AT5G18230_circ_g.12 AT5G18230_circ_g.13 AT5G18230_circ_g.14 AT5G18230_circ_g.15 AT5G18230_circ_g.16 AT5G18230_circ_g.17 AT5G18230_circ_g.18 AT5G18230_circ_g.19 |
| Support reads | 9 |
| Tissues | root, whole_plant, leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT5G18230.4:3 AT5G18230.1:3 AT5G18230.2:3 AT5G18230.3:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.380930736 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
6024655-6024618(-) |
| Potential amino acid sequence |
MKSSLAASASQVRTHLETSITRHKDHIIKLELILRLLDNDELSPEQVNDVKDFLDDYVERNQDD FDEFSDVDELYSTLPLDEVEGLEDLVTAGPLVKGTPLSMKSSLAASASQVRTHLETSITRHKDH IIKLELILRLLDNDELSPEQVNDVKDFLDDYVERNQDDFDEFSDVDELYSTLPLDEVEGLEDLV TAGPLVKGTPLSMKSSLAASASQVRTHLETSITRHKDHIIKLELILRLLDNDELSPEQVNDVKD FLDDYVERNQDDFDEFSDVDELYSTLPLDEVEGLEDLVTAGPLVKGTPLSMKSSLAASASQVR( -) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Chu et al., 2017;Zhang et al., 2019 |