Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G32810_circ_g.9 |
ID in PlantcircBase | ath_circ_016169 |
Alias | At_ciR1863 |
Organism | Arabidpsis thaliana |
Position | chr2: 13923993-13924136 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | find_circ, CIRI-full |
Parent gene | AT2G32810 |
Parent gene annotation |
Beta-galactosidase 9 |
Parent gene strand | - |
Alternative splicing | AT2G32810_circ_g.3 AT2G32810_circ_g.4 AT2G32810_circ_g.5 AT2G32810_circ_g.6 AT2G32810_circ_g.7 AT2G32810_circ_g.8 |
Support reads | 5 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT2G32810.1:1 AT2G32810.2:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.170140047 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
13924062-13923995(-) |
Potential amino acid sequence |
MALGLGAGVPWVMCKQTDAPENIIENEYGDVEKSYGQKGKDYVKWAASMALGLGAGVPWVMCKQ TDAPENIIENEYGDVEKSYGQKGKDYVKWAASMALGLGAGVPWVMCKQTDAPENIIENEYGDVE KSYGQKGKDYVKWAASMALGLGAGVPWVMCKQTDAPENI(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |