Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT2G32810_circ_g.9 |
| ID in PlantcircBase | ath_circ_016169 |
| Alias | At_ciR1863 |
| Organism | Arabidpsis thaliana |
| Position | chr2: 13923993-13924136 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | find_circ, CIRI-full |
| Parent gene | AT2G32810 |
| Parent gene annotation |
Beta-galactosidase 9 |
| Parent gene strand | - |
| Alternative splicing | AT2G32810_circ_g.3 AT2G32810_circ_g.4 AT2G32810_circ_g.5 AT2G32810_circ_g.6 AT2G32810_circ_g.7 AT2G32810_circ_g.8 |
| Support reads | 5 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT2G32810.1:1 AT2G32810.2:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.170140047 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
13924062-13923995(-) |
| Potential amino acid sequence |
MALGLGAGVPWVMCKQTDAPENIIENEYGDVEKSYGQKGKDYVKWAASMALGLGAGVPWVMCKQ TDAPENIIENEYGDVEKSYGQKGKDYVKWAASMALGLGAGVPWVMCKQTDAPENIIENEYGDVE KSYGQKGKDYVKWAASMALGLGAGVPWVMCKQTDAPENI(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |