Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.006G253200_circ_g.2 |
| ID in PlantcircBase | gra_circ_000677 |
| Alias | Chr06:49629657|49630975 |
| Organism | Gossypium raimondii |
| Position | chrChr06: 49629657-49630975 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | ue-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.006G253200 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | orai.006G253200_circ_g.1 |
| Support reads | 3 |
| Tissues | ovule |
| Exon boundary | Yes-No |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.006G253200.2:3 Gorai.006G253200.3:3 Gorai.006G253200.1:3 Gorai.006G253200.4:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.49585484 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
49630832-49630945(-) 49630871-49629677(+) |
| Potential amino acid sequence |
METARCWLNKLKSKDKLRPSKKKEAANGKEGSKPPASEEAPSKVTKQRVEAAKQYIENHYKKQM KSLQERKERRDILEKKLADAEVSEEEQNNLLKCFEKKETEYMRLQRHKMGADDFEPLTMIGKGA FGEVRICKEKATGHVYAMKKLKKSEMLRRGQNLFVGYFGKQ*(-) MYILATLFINNLILRDQILQTFSSSLFTEISNKQVLASAKHF*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |