Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os11g0148500_circ_g.8 |
ID in PlantcircBase | osa_circ_008461 |
Alias | NA |
Organism | Oryza sativa |
Position | chr11: 2240998-2241425 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os11g0148500 |
Parent gene annotation |
Cytosolic pyruvate kinase, Plant morphological development (Os11 t0148500-02) |
Parent gene strand | - |
Alternative splicing | Os11g0148500_circ_g.1 Os11g0148500_circ_g.2 Os11g0148500_circ_g.3 Os11g0148500_circ_g.4 Os11g0148500_circ_g.5 Os11g0148500_circ_g.6 Os11g0148500_circ_g.7 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os11t0148500-02:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.349495658 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
2241105-2241411(-) 2241023-2241411(-) |
Potential amino acid sequence |
MAGKPAVVTRVVDSMTDNLRPTRAEATDVANAVLDGFESF*(-) MWQMLYLTGLNHFDEILQEADGIILSRGNLGIDLPPEKVFLFQKSALHKCNMAGKPAVVTRVVD SMTDNLRPTRAEATDVANAVLDGFESF*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |