Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0671900_circ_g.3 |
ID in PlantcircBase | osa_circ_025902 |
Alias | NA |
Organism | Oryza sativa |
Position | chr4: 34282543-34283304 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder |
Parent gene | Os04g0671900 |
Parent gene annotation |
Transcription factor, Regulator for phosphate homeostasis (Os04t 0671900-01);Similar to Auxin response factor 12. (Os04t0671900-0 2);Similar to Auxin response factor 12. (Os04t0671900-03) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 38 |
Tissues | seed |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os04t0671900-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_014997 |
PMCS | 0.235385335 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
34283210-34282945(+) 34283248-34283220(-) |
Potential amino acid sequence |
MCMLSLERTEEGITVCGRLARLIPSKSWFFSFLHRSPIGTRPTDWVCITNFSYSPHIPANA*(+ ) MPSSVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLSKYIKAVFHTRISVGMRF RMLFETEESSVRRYMGTITEVSDADPVRWPSSYWRSVKEREKPAFTWNKTCQSATDCDAFLCSF KR*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |