Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0158200_circ_g.1 |
| ID in PlantcircBase | osa_circ_026706 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 3425218-3426814 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os05g0158200 |
| Parent gene annotation |
Peptidase, trypsin-like serine and cysteine domain containing pr otein. (Os05t0158200-01) |
| Parent gene strand | + |
| Alternative splicing | Os05g0158200_circ_igg.1 Os05g0157600_circ_igg.1 Os05g0158400_circ_igg.1 Os05g0158200_circ_igg.2 Os05g0157500_circ_ag.1 Os05g0157600_circ_ag.1 Os05g0157600_circ_ag.2 Os05g0157600_circ_ag.3 Os05g0157600_circ_ag.4 Os05g0158200_circ_ag.1 Os05g0158400_circ_g.1 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os05t0158200-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.435516678 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3425308-3425251(+) |
| Potential amino acid sequence |
MVLGMSRSIVRVSSPPSEGKLISPRTGFVISWDGATKRAMIVTLFTYFKKKPHEPQPELQVHLP DKSIVQGRLIFMNRHYNLSILEITSDLPLQVPAFGSAPKYGQKILALSRDENMSLVARRGAITW SDGSFMWRNHYMFVDCDVPEGGVGGPVVDSCGSSIAMVYRAGPGAVIISISIICTFFEMWKQFS CSTSEANSPAR*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |