Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os05g0158200_circ_g.1 |
ID in PlantcircBase | osa_circ_026706 |
Alias | NA |
Organism | Oryza sativa |
Position | chr5: 3425218-3426814 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os05g0158200 |
Parent gene annotation |
Peptidase, trypsin-like serine and cysteine domain containing pr otein. (Os05t0158200-01) |
Parent gene strand | + |
Alternative splicing | Os05g0158200_circ_igg.1 Os05g0157600_circ_igg.1 Os05g0158400_circ_igg.1 Os05g0158200_circ_igg.2 Os05g0157500_circ_ag.1 Os05g0157600_circ_ag.1 Os05g0157600_circ_ag.2 Os05g0157600_circ_ag.3 Os05g0157600_circ_ag.4 Os05g0158200_circ_ag.1 Os05g0158400_circ_g.1 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os05t0158200-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.435516678 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
3425308-3425251(+) |
Potential amino acid sequence |
MVLGMSRSIVRVSSPPSEGKLISPRTGFVISWDGATKRAMIVTLFTYFKKKPHEPQPELQVHLP DKSIVQGRLIFMNRHYNLSILEITSDLPLQVPAFGSAPKYGQKILALSRDENMSLVARRGAITW SDGSFMWRNHYMFVDCDVPEGGVGGPVVDSCGSSIAMVYRAGPGAVIISISIICTFFEMWKQFS CSTSEANSPAR*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |