Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0531500_circ_g.1 |
ID in PlantcircBase | osa_circ_001996 |
Alias | Os_ciR5801 |
Organism | Oryza sativa |
Position | chr1: 19137373-19137515 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os01g0531500 |
Parent gene annotation |
Dienelactone hydrolase domain containing protein. (Os01t0531500- 01);Similar to protein usf. (Os01t0531500-02) |
Parent gene strand | + |
Alternative splicing | Os01g0531500_circ_g.2 Os01g0531500_circ_g.3 |
Support reads | 2/1 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0531500-01:1 Os01t0531500-02:1 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_002117* |
PMCS | 0.31352465 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
19137381-19137377(+) 19137467-19137464(-) |
Potential amino acid sequence |
MPMLLEKRMLLELLFCKSGGGLTMRSRIMLSTFPKLVKDTELSFQNF*(+) MILDLIVNPPPLLQNNNSRSILFSNNIGIKSSGMRALYPSPIWEMWTA*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |