Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.009G260200_circ_g.1 |
| ID in PlantcircBase | gra_circ_000979 |
| Alias | Chr09:21442984|21443216 |
| Organism | Gossypium raimondii |
| Position | chrChr09: 21442984-21443216 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | ue-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.009G260200 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 5 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.009G260200.3:1 Gorai.009G260200.5:1 Gorai.009G260200.1:1 Gorai.009G260200.2:1 Gorai.009G260200.6:1 Gorai.009G260200.4:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.888094242 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
21443079-21442998(+) |
| Potential amino acid sequence |
MAEALGGVQQNQNALLSQPVPTSDPLTLHLARMSRNQLNEIMSELKTLKNN*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |