Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0595100_circ_g.5 |
| ID in PlantcircBase | osa_circ_029235 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 29634785-29635270 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os05g0595100 |
| Parent gene annotation |
Uridine-diphospho-(UDP)-glucose 4-epimerase, Cell wall carbohydr ate partitioning during nitrogen (N) limitation (Os05t0595100-01 ) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 4 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os05t0595100-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.1443756 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
29635024-29634812(+) 29635266-29634812(+) 29635037-29634838(-) |
| Potential amino acid sequence |
MVAAFEKASGKKIPLVFAGRRPGDAEIVYAQTAKAEKELKWKFVTISMLLI*(+) MEVRDYIHVVDLADGHIAALRKLYEDSDRIGCEVYNLGTGKGTSVLEMVAAFEKASGKKIPLVF AGRRPGDAEIVYAQTAKAEKELKWKFVTISMLLI*(+) MLQPFPAQMSPFQCPDCTPHILFYQNLHRASLTRRYDHPLDQQHGYSHELPFQFLLSFGSLSVN DLGISRPSSSKYKRDFLSRSFLECCNHFQHRCPLSSAQIVHLTSYSIRIFIELP*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |