Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d042442_circ_g.2 |
| ID in PlantcircBase | zma_circ_007699 |
| Alias | zma_circ_0001213, GRMZM2G004320_C1 |
| Organism | Zea mays |
| Position | chr3: 167607300-167608076 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | u-circRNA |
| Identification method | find_circ, CIRI2 |
| Parent gene | Zm00001d042442 |
| Parent gene annotation |
Protein-S-isoprenylcysteine O-methyltransferase |
| Parent gene strand | + |
| Alternative splicing | Zm00001d042442_circ_g.1 |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Zm00001d042442_T004:3 Zm00001d042442_T003:3 Zm00001d042442_T005:3 Zm00001d042442_T002:3 Zm00001d042442_T001:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.174397523 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
167608013-167607309(+) 167608056-167608055(+) |
| Potential amino acid sequence |
MNMHREYTLEYHLLNESMALANTSY*(+) MKVWHLQTLLISKQYVLAMGFAMLEHLTEILILPEVKEFWFVSNIGLLMVIIGEIIRKLAVVTA GRAFTHVIRTYYEDQHQLITHGLYRFMRHPGYSGFLIWAVGTQVMLCNPLSTVAFTLVLWRFFS KRIPYEEFFLKQFFGSEYDEYAQRVHSGIPFIK*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | responsive to drought stress |
| Other Information | |
|---|---|
| References | Ma et al., 2021b;Zhang et al., 2019 |