Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os07g0515100_circ_g.7 |
ID in PlantcircBase | osa_circ_034042 |
Alias | Os_ciR4429 |
Organism | Oryza sativa |
Position | chr7: 19770202-19770551 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Os07g0515100 |
Parent gene annotation |
Calcium-dependent protein kinase, isoform 2 (EC 2.7.1.-) (CDPK 2 ). (Os07t0515100-01);Calcium-dependent protein kinase, isoform 2 (EC 2.7.1.-) (CDPK 2). (Os07t0515100-02) |
Parent gene strand | - |
Alternative splicing | Os07g0515100_circ_g.3 Os07g0515100_circ_g.4 Os07g0515100_circ_g.5 Os07g0515100_circ_g.6 |
Support reads | 5 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os07t0515150-00:2 Os07t0515150-00:2 Os07t0515100-01:2 Os07t0515100-02:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.542025262 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
19770449-19770443(-) |
Potential amino acid sequence |
MLTQDPKKRITSAQVLQHPWLRDGEASDKPIDSAVLSRMKQFRAMNKLKKMALKKLKREYLMLF FKGRLTLRVNHGHQYPRVLKTLLERC*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |