Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0515100_circ_g.7 |
| ID in PlantcircBase | osa_circ_034042 |
| Alias | Os_ciR4429 |
| Organism | Oryza sativa |
| Position | chr7: 19770202-19770551 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os07g0515100 |
| Parent gene annotation |
Calcium-dependent protein kinase, isoform 2 (EC 2.7.1.-) (CDPK 2 ). (Os07t0515100-01);Calcium-dependent protein kinase, isoform 2 (EC 2.7.1.-) (CDPK 2). (Os07t0515100-02) |
| Parent gene strand | - |
| Alternative splicing | Os07g0515100_circ_g.3 Os07g0515100_circ_g.4 Os07g0515100_circ_g.5 Os07g0515100_circ_g.6 |
| Support reads | 5 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os07t0515150-00:2 Os07t0515150-00:2 Os07t0515100-01:2 Os07t0515100-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.542025262 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
19770449-19770443(-) |
| Potential amino acid sequence |
MLTQDPKKRITSAQVLQHPWLRDGEASDKPIDSAVLSRMKQFRAMNKLKKMALKKLKREYLMLF FKGRLTLRVNHGHQYPRVLKTLLERC*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |