Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d019075_circ_g.2 |
ID in PlantcircBase | zma_circ_009235 |
Alias | zma_circ_0002600, ZmciR293 |
Organism | Zea mays |
Position | chr7: 15394527-15394873 JBrowse» |
Reference genome | AGPv4.38 |
Type | e-circRNA |
Identification method | find_circ, CIRI2 |
Parent gene | Zm00001d019075 |
Parent gene annotation |
RNAligase |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d019075_T004:2 Zm00001d019075_T006:2 Zm00001d019075_T001:2 Zm00001d019075_T003:2 Zm00001d019075_T005:2 Zm00001d019075_T002:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.205509067 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
15394829-15394612(+) 15394866-15394821(-) |
Potential amino acid sequence |
MEEVLKNFPQAPFDAGNLPPHFLLLMMHYVKKELQHLYAKPLMK*(+) MEPEESFSKPLPFALNFDEAQSGQPDLQGSHLALLHDLLTLVQLYQLFHQGFCIQVLQFLLHIM HHKQQKMRRQISGVKWSLRKVFQNLFHLH*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b;Zhang et al., 2019 |