Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d019075_circ_g.2 |
| ID in PlantcircBase | zma_circ_009235 |
| Alias | zma_circ_0002600, ZmciR293 |
| Organism | Zea mays |
| Position | chr7: 15394527-15394873 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | e-circRNA |
| Identification method | find_circ, CIRI2 |
| Parent gene | Zm00001d019075 |
| Parent gene annotation |
RNAligase |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Zm00001d019075_T004:2 Zm00001d019075_T006:2 Zm00001d019075_T001:2 Zm00001d019075_T003:2 Zm00001d019075_T005:2 Zm00001d019075_T002:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.205509067 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
15394829-15394612(+) 15394866-15394821(-) |
| Potential amino acid sequence |
MEEVLKNFPQAPFDAGNLPPHFLLLMMHYVKKELQHLYAKPLMK*(+) MEPEESFSKPLPFALNFDEAQSGQPDLQGSHLALLHDLLTLVQLYQLFHQGFCIQVLQFLLHIM HHKQQKMRRQISGVKWSLRKVFQNLFHLH*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ma et al., 2021b;Zhang et al., 2019 |