Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0827900_circ_g.2 |
| ID in PlantcircBase | osa_circ_017338 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 35576668-35577143 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0827900 |
| Parent gene annotation |
Similar to Microsomal signal peptidase 21 kDa subunit. (Os02t082 7900-01);Hypothetical conserved gene. (Os02t0827900-02);Hypothet ical conserved gene. (Os02t0827900-03);Non-protein coding transc ript. (Os02t0827900-04) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0827900-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.341141317 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
35576856-35576718(+) 35576907-35576670(-) |
| Potential amino acid sequence |
MLLKPKLPMCVKNSVVHRIVVTFCEEINLCIIPSFVNLNNWFLSHHQCHPPSFG*(+) MDDRILYTHGQLWLQQHHIMGRAIGYLPKAGWVTLVMTEKPVIKVHERRDNAQVDFLTKGDNNP MDDRILYTHGQLWLQQHHIMGRAIGYLPKAGWVTLVMTEKPVIKVHERRDNAQVDFLTKGDNNP MDDRILYTHGQLWLQQHHIMGRAIGYLPKAGWVTLVMTEKPVIKVHERRDNAQVDFLTKGDNNP MDDRILYTHGQLWLQQHHIMGRAIGYLPKAGWVTLVMTEKPVIK(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |