Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0249900_circ_g.1 |
| ID in PlantcircBase | osa_circ_038570 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr9: 3792819-3792925 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | KNIFE, PcircRNA_finder, circRNA_finder, find_circ |
| Parent gene | Os09g0249900 |
| Parent gene annotation |
Similar to Ferredoxin-thioredoxin reductase catalytic chain. (Os 09t0249900-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os09t0249900-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.130062305 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3792907-3792841(+) 3792842-3792841(+) 3792892-3792885(-) |
| Potential amino acid sequence |
MHSSSSRSVGCCPAMMSMASTTASPFCPSPMPRGRKCTVRVQDRWAAVQQ*(+) MMSMASTTASPFCPSPMPRGRKCTVRVQDRWAAVQQ*(+) MGEGQKGLAVVEAIDIIAGQQPTDLELELCICVLWAWVKGKRGWRWWRPSTSLLDSSPPILNSN CAFASSGHG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |