Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.011G005300_circ_g.1 |
| ID in PlantcircBase | gra_circ_001185 |
| Alias | Chr11:432060|433071 |
| Organism | Gossypium raimondii |
| Position | chrChr11: 432060-433071 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | ue-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.011G005300 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | ovule |
| Exon boundary | No-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.011G005300.1:3 Gorai.011G005300.2:3 Gorai.011G005300.3:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.452001836 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
433019-432090(+) 432062-432074(+) |
| Potential amino acid sequence |
MELHLSNVLSVNMLLTLVYAEPDSLQWV*(+) MQSQIVCSGCRSNLLYPRGATNVCCALCNTVTQVPLPGMDMGQLICGGCRTLLMYARGGTSVRC SCCHTLNLAPAPNQIAHINCGHCRTTLMYPYGAPSVKCAICQYVTNVGICRAR*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |