Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | GLYMA_19G237700_circ_g.1 |
| ID in PlantcircBase | gma_circ_007685 |
| Alias | gma-circRNA2658 |
| Organism | Glycine max |
| Position | chr19: 48647825-48649246 JBrowse» |
| Reference genome | v2.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | GLYMA_19G237700 |
| Parent gene annotation |
hypothetical protein |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | flower bud |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | KRG96869:4 KRG96868:4 KRG96867:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.041381698 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
48648469-48647921(+) 48649187-48647892(+) 48647890-48649160(-) |
| Potential amino acid sequence |
MLQINKKEDIRMGIVRSDYMIDEKTKSLLQIEMNTISTSFALIGCLMTGLHKSLLSQYGKFLGL NSNRVPANNAVDQSAEALAKAWSEYNNPRDQEEFLVWAWYISHFPYYLGHFLKVIGSKGAN*(+ ) MPLISLQRPWLKLGVSITIPEIRKSSWCGPGTSPTFLITWAIS*(+) MAQVIRKVGDVPGPHQELFLISGIVILTPSFSQGLCRLINGIIGRNPIGI*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chen et al., 2018 |