Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT5G01970_circ_g.1 |
ID in PlantcircBase | ath_circ_035955 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr5: 373660-373863 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | KNIFE, PcircRNA_finder |
Parent gene | AT5G01970 |
Parent gene annotation |
Heat-inducible transcription repressor |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 3 |
Tissues | whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT5G01970.2:1 AT5G01970.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.255873702 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
373711-373662(-) |
Potential amino acid sequence |
MQLNHIEHETQLKASRDDGRTLVENKTADIIQETRKLQTRRRGTGGEDENQNQSYGVSSSWKKS PEQPMQLNHIEHETQLKASRDDGRTLVENKTADIIQETRKLQTRRRGTGGEDENQNQSYGVSSS WKKSPEQPMQLNHIEHETQLKASRDDGRTLVENKTADIIQETRKLQTRRRGTGGEDENQNQSYG VSSSWKKSPEQPMQLNHIEHETQLKASRD(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |