Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | GLYMA_14G058300_circ_g.4 |
| ID in PlantcircBase | gma_circ_007080 |
| Alias | gma-circRNA2007 |
| Organism | Glycine max |
| Position | chr14: 4665024-4665505 JBrowse» |
| Reference genome | v2.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | GLYMA_14G058300 |
| Parent gene annotation |
hypothetical protein |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | flower bud |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | KRH14933:2 KRH14932:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.202471732 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4665132-4665025(+) |
| Potential amino acid sequence |
MIQRHSAFPLLKVFQNTATEEEFAQLAQEHSEIWQLCQEFEGFLVEIQLQVLQLPYILFGQTVH ENVPLP*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chen et al., 2018 |