Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Cotton_A_19549_circ_g.1 |
| ID in PlantcircBase | gar_circ_000553 |
| Alias | CA_chr3_BGI-A2_v1.0:45511770|45512865 |
| Organism | Gossypium arboreum |
| Position | chrCA_chr3_BGI-A2_v1.0: 45511770-45512865 JBrowse» |
| Reference genome | BGI-A2_v1.0 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Cotton_A_19549 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 7 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Cotton_A_19549:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | gra_circ_000388 |
| PMCS |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
45511981-45512336(-) 45511839-45512805(-) 45512477-45511841(+) |
| Potential amino acid sequence |
MQLDMSEDIKLGSPDDASNNLDSDFNMLAVSQSGNPTVNQRRAALFRDESNRRWQMLQEPSCSS LQPLSTGYLERHMQGGNMYGLQVQTKLIAKHFQELFLLRLCFAFLFLMVFLNLGILKRCKKI*( -) MSRIGGGKCYKNPRAVVFNHFQQVTWKGICKEATCMAYRCKRS*(-) MQSTVLARIALENVLLSTSFAPVSHTCCLLAYAFPGNLLKVVEDYCTRVLVAFATSDSTHL*(+ ) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |