Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0664700_circ_g.1 |
ID in PlantcircBase | osa_circ_015866 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 26985061-26985639 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder |
Parent gene | Os02g0664700 |
Parent gene annotation |
Conserved hypothetical protein. (Os02t0664700-01);Similar to cDN A clone:J013020D20, full insert sequence. (Os02t0664700-02) |
Parent gene strand | - |
Alternative splicing | Os02g0664700_circ_g.2 |
Support reads | 1 |
Tissues | shoot, root, anther |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0664700-02:2 Os02t0664700-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.241258247 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
26985155-26985102(+) |
Potential amino acid sequence |
MRNPMLHIKCNCTSLARVQFGRSPKQRRCLNFFSPKPQVYGDQHAIPHTQALHETNTEVGDGGP DLVVGGVMEPRLLHLTLLRRRRCGCRHIERRSSRRDLLLGNDRGRDHGLRWWSWPRWRRRGGGD ISGCGQLRHLSESREQHHCFGNQ*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |