Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0362300_circ_g.3 |
| ID in PlantcircBase | osa_circ_006588 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr10: 11194987-11195648 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os10g0362300 |
| Parent gene annotation |
Similar to Histidine kinase 3. (Os10t0362300-01);Similar to Hist idine kinase. (Os10t0362300-02);Histidine kinase, Cytokinin sign aling (Os10t0362300-03);Histidine kinase, Cytokinin signaling (O s10t0362300-04) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os10t0362300-04:1 Os10t0362300-03:1 Os10t0362300-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.160925227 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
11195614-11195130(+) 11195590-11195611(-) |
| Potential amino acid sequence |
MHSNEDMTLFSKLELQDSNRAESADSDVAARSHCIPSLRRWYMVTSARAHLPSTTSALIP*(+) MEALDDTSPENIEVTANSKNTMPYNTLSGLEVANNRKTLESFRMFKDSSDAIDSVNLLVTVEDT GIGITKDAQTRIFTPFMQADGSTSRTYGGTGIGLSITKRLVELMGGEIGFVSKPGVSSTFSFTA IFKENRKDPGDIKRYCPEPTPPDFQGMRALVVDGRCARAEVTMYHLRRLGIQCDLAATSESALS ALLESCNSSLLNKVISSFECI*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |