Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | POPTR_0001s40440_circ_g.5 |
| ID in PlantcircBase | pop_circ_000455 |
| Alias | Chr01:41334905-41335359 |
| Organism | Populus trichocarpa |
| Position | chr1: 39888372-39888826 JBrowse» |
| Reference genome | Populus trichocarpa genome v3.0 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | POPTR_0001s40440 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | stem xylem |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | POPTR_0001s40440.2:2 POPTR_0001s40440.1:2 POPTR_0001s40440.4:2 POPTR_0001s40440.3:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.147515751 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
39888512-39888743(-) 39888391-39888519(-) |
| Potential amino acid sequence |
MVWQEEIDENDEKLLEAFLSKDAGPQRTLADLIIEKLKKTDANVSSDDILGDELENLEASVDSA EGDSSRGEKP*(-) MQMFPQMISSGMSSKILKQALIQQKEIQAEERNPNFNALEEELPEPEGEECAEDQIDDFSGFSE TQSQFNDYPE*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Liu et al., 2021 |