Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Csa3G848310_circ_g.4 |
| ID in PlantcircBase | csa_circ_002134 |
| Alias | Chr3:34724529_34724832 |
| Organism | Cucumis sativus |
| Position | chrChr3: 34724529-34724832 JBrowse» |
| Reference genome | Cucumis sativus v1.5 |
| Type | e-circRNA |
| Identification method | Find_circ |
| Parent gene | Csa3G848310 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | Csa3G848310_circ_g.1 Csa3G848310_circ_g.2 Csa3G848310_circ_g.3 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Csa3G848310.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.33568824 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
34724834-34724792(-) 34724579-34724806(-) 34724542-34724792(-) |
| Potential amino acid sequence |
MWPDLIQKAKEGGLDVIETYVFWNGHEPEPGKYYFEGNYDLVRFVKLVHQAGLYVHLRIGPYVC AEWNFGCGQILFRRLRKEA* MFISGLVLMFVLNGTLDVARSYSEG* MELWMWPDLIQKAKEGGLDVIETYVFWNGHEPEPGKYYFEGNYDLVRFVKLVHQAGLYVHLRIG PYVCAEWNFGCGQILFRRLRKEA* |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | He et al., 2020 |