Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0301700_circ_g.5 |
| ID in PlantcircBase | osa_circ_027320 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 13544983-13545185 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os05g0301700 |
| Parent gene annotation |
Similar to Cytochrome c1 (Fragment). (Os05t0301700-01) |
| Parent gene strand | - |
| Alternative splicing | Os05g0301700_circ_g.1 Os05g0301700_circ_g.2 Os05g0301700_circ_g.3 Os05g0301700_circ_g.4 |
| Support reads | 66 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os05t0301700-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.309121182 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
13545008-13545001(+) 13545123-13545086(+) 13545063-13545150(-) |
| Potential amino acid sequence |
MPACGQGYSAAAKPCSASSAEAIVAKLKRPEAPTPRRANALSPAEDSSCFIRNEDSRDEPMHGH KS*(+) MLSVQRRILHALSGTRIAEMSRCMVIRAKNASMWPGIFSCCQTMLSFICRSYCSKA*(+) MKLSMVWQQLNIPGHMLAFLALMTMHRLISAILVPDKA*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |