Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d052632_circ_g.1 |
| ID in PlantcircBase | zma_circ_008197 |
| Alias | Zm04circ00083, zma_circ_0001541, GRMZM2G098674_C1 |
| Organism | Zea mays |
| Position | chr4: 195432513-195433263 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | u-circRNA |
| Identification method | CIRI2, find_circ |
| Parent gene | Zm00001d052632 |
| Parent gene annotation |
ARM repeat superfamily protein |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf, endosperm, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Zm00001d052632_T004:2 Zm00001d052632_T003:3 Zm00001d052632_T007:3 Zm00001d052632_T016:3 Zm00001d052632_T010:3 Zm00001d052632_T005:3 Zm00001d052632_T012:3 Zm00001d052632_T002:3 Zm00001d052632_T014:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.073112696 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
195432622-195432531(+) |
| Potential amino acid sequence |
MCEVGQAAPALVAEGGSQALALTDGLLRCVAFTSEDWEIAESTLQFWNYLRPF*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | responsive to drought stress |
| Other Information | |
|---|---|
| References | Han et al., 2020; Ma et al., 2021b;Zhang et al., 2019 |