Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d052632_circ_g.1 |
ID in PlantcircBase | zma_circ_008197 |
Alias | Zm04circ00083, zma_circ_0001541, GRMZM2G098674_C1 |
Organism | Zea mays |
Position | chr4: 195432513-195433263 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | CIRI2, find_circ |
Parent gene | Zm00001d052632 |
Parent gene annotation |
ARM repeat superfamily protein |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, endosperm, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d052632_T004:2 Zm00001d052632_T003:3 Zm00001d052632_T007:3 Zm00001d052632_T016:3 Zm00001d052632_T010:3 Zm00001d052632_T005:3 Zm00001d052632_T012:3 Zm00001d052632_T002:3 Zm00001d052632_T014:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.073112696 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
195432622-195432531(+) |
Potential amino acid sequence |
MCEVGQAAPALVAEGGSQALALTDGLLRCVAFTSEDWEIAESTLQFWNYLRPF*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Han et al., 2020; Ma et al., 2021b;Zhang et al., 2019 |