Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.004G065000_circ_g.1 |
| ID in PlantcircBase | gra_circ_000339 |
| Alias | Chr04:6561850|6562637 |
| Organism | Gossypium raimondii |
| Position | chrChr04: 6561850-6562637 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.004G065000 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 3 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.004G065000.2:4 Gorai.004G065000.4:4 Gorai.004G065000.3:4 Gorai.004G065000.1:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.157464615 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
6562532-6562632(-) 6561919-6562625(-) 6562567-6561883(+) |
| Potential amino acid sequence |
MGIEEDNIRKHTTPAYRAPEMWDLFRRELINEKVDIWALGCLLFRICYFKNAFDGESKLQILNG NYRIPDLPKYSSSITNLIKDMLQASPVDRPDITQVWFRVNEQLPAALQKSLPDRPPEMPSTEGT *(-) MSSCLLLYRSLYLIGHLKCHLLKGLES*(-) MCSRNHTTSIIHQNPTECSQLSSPFSRWHFRWPIR*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |