Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0143800_circ_g.1 |
| ID in PlantcircBase | osa_circ_000291 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 2375016-2375398 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os01g0143800 |
| Parent gene annotation |
Mitochondrial glycoprotein family protein. (Os01t0143800-01);Mit ochondrial glycoprotein family protein. (Os01t0143800-03) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 10 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0143800-01:1 Os01t0143800-03:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.259956419 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2375352-2375349(-) 2375069-2375372(-) |
| Potential amino acid sequence |
MSVVILKRDYKDEKIEVIVSMPNLEGGPEFDDEEAEGEGKNASKDDEDEEEDESAGDSSVSLKV TVSKGSGPKLEFTCTAFREEITIDDMLIVENAATEGDEKFPYEGPEFTNLFRKTSLLKSLTKKG *(-) MQPQKEMRNSLTRALNSRTCSGKLPF*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |