Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0143800_circ_g.1 |
ID in PlantcircBase | osa_circ_000291 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 2375016-2375398 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | Os01g0143800 |
Parent gene annotation |
Mitochondrial glycoprotein family protein. (Os01t0143800-01);Mit ochondrial glycoprotein family protein. (Os01t0143800-03) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 10 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os01t0143800-01:1 Os01t0143800-03:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.259956419 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
2375352-2375349(-) 2375069-2375372(-) |
Potential amino acid sequence |
MSVVILKRDYKDEKIEVIVSMPNLEGGPEFDDEEAEGEGKNASKDDEDEEEDESAGDSSVSLKV TVSKGSGPKLEFTCTAFREEITIDDMLIVENAATEGDEKFPYEGPEFTNLFRKTSLLKSLTKKG *(-) MQPQKEMRNSLTRALNSRTCSGKLPF*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |