Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d042804_circ_g.1 |
| ID in PlantcircBase | zma_circ_007736 |
| Alias | zma_circ_0001247, GRMZM2G039650_C1 |
| Organism | Zea mays |
| Position | chr3: 180455794-180456690 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | e-circRNA |
| Identification method | find_circ, CIRI2 |
| Parent gene | Zm00001d042804 |
| Parent gene annotation |
RNA polymerase II C-terminal domain phosphatase-like 2 |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Zm00001d042804_T002:3 Zm00001d042804_T004:3 Zm00001d042804_T001:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.070751802 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
180455917-180455940(+) 180455810-180456633(-) |
| Potential amino acid sequence |
MREPSGSALKLDHSNNVDTLSSIMSLIREHCLEDQHVVFRDEVQNSSPARNEEYHFQVELAGLI LGRGVGSDREAAKLLTVICHLVLQLLEFLRKIQGSPLGGVVMAFWRMLLVQITISLCENLLEVH *(+) MTNNCQKLRGLSVRTNAPPENQSC*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | responsive to drought stress |
| Other Information | |
|---|---|
| References | Ma et al., 2021b;Zhang et al., 2019 |