Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0563800_circ_g.5 |
| ID in PlantcircBase | osa_circ_034299 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr7: 22573387-22574759 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os07g0563800 |
| Parent gene annotation |
Similar to ARF GAP-like zinc finger-containing protein ZIGA3. (O s07t0563800-01);Arf GTPase activating protein family protein. (O s07t0563800-02);Arf GTPase activating protein family protein. (O s07t0563800-03);Similar to ARF GAP-like zinc finger-containing p rotein ZIGA3. (Os07t0563800-04) |
| Parent gene strand | - |
| Alternative splicing | Os07g0563800_circ_g.6 Os07g0563800_circ_g.7 Os07g0563800_circ_g.8 Os07g0563800_circ_g.9 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os07t0563800-02:3 Os07t0563800-04:3 Os07t0563800-01:3 Os07t0563800-03:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.229709717 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
22574711-22573822(+) 22573805-22574702(-) |
| Potential amino acid sequence |
MMVLMTHSSVSISCPRIFSNRLMISFFTFTCGAAGAEDTVTAGESLNKSSMPDVDWGLLSTGLA ESFLSELGTGSADWKPSHALSSLEDDSASFSVVPSIDNMLKRSVA*(+) MLSMDGTTEKEAESSSNDDSAWEGFQSAEPVPSSDKKDSAKPVESKPQSTSGIEDLFKDSPAVT VSSAPAAPQVNVKNDIMSLFEKIRGQEMDTEEWVIKTIIWC*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |