Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0492300_circ_g.6 |
| ID in PlantcircBase | osa_circ_007252 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr10: 18689809-18692544 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os10g0492300 |
| Parent gene annotation |
Similar to IAP100. (Os10t0492300-01) |
| Parent gene strand | - |
| Alternative splicing | Os10g0492300_circ_g.2 Os10g0492300_circ_g.3 Os10g0492300_circ_g.4 Os10g0492300_circ_g.5 Os10g0492300_circ_g.7 Os10g0492300_circ_g.8 Os10g0492300_circ_g.9 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os10t0492300-01:6 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.098305662 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
18692243-18692535(-) 18689815-18692535(-) |
| Potential amino acid sequence |
MEIAKRIDRNAGVGQQQAFEKLIFVTNLVFRDAYEYLLPWKRLFGVHESQIDDVMRESAKSLYA SLLKSIGRGLDIGTLIEVRRSQLAYKLSDEIRR*(-) MRYGVSTEDATFKAELCDLYGRFVFSLIHPGYEDLEGTEVETIIKFKKALGLNDIDAANVHMEI AKRIDRNAGVGQQQAFEKLIFVTNLVFRDAYEYLLPWKRLFGVHESQIDDVMRESAKSLYASLL KSIGRGLDIGTLIEVRRSQLAYKLSDEIRR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |