Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G46960_circ_g.2 |
| ID in PlantcircBase | ath_circ_026328 |
| Alias | At_ciR1980 |
| Organism | Arabidpsis thaliana |
| Position | chr3: 17296097-17296458 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | AT3G46960 |
| Parent gene annotation |
DExH-box ATP-dependent RNA helicase DExH11 |
| Parent gene strand | - |
| Alternative splicing | AT3G46960_circ_g.1 |
| Support reads | 4 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT3G46960.3:2 AT3G46960.1:2 AT3G46960.2:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.330592734 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
17296148-17296099(-) |
| Potential amino acid sequence |
MSEEAVTGSSDKQLRKESKLSIQFDDLFKKAWEEDTFSELEGDDHTAGSESPKAEAEPDAKASI SNEVSKGLETDVTVLDEILSSAKTAIMSEEAVTGSSDKQLRKESKLSIQFDDLFKKAWEEDTFS ELEGDDHTAGSESPKAEAEPDAKASISNEVSKGLETDVTVLDEILSSAKTAIMSEEAVTGSSDK QLRKESKLSIQFDDLFKKAWEEDTFSELEGDDHTAGSESPKAEAEPDAKASISNEVSKGLETDV TVLDEILSSAKTAIMSEEAVTGSSDKQLRKE(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |