Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os12g0210400_circ_g.1 |
ID in PlantcircBase | osa_circ_010827 |
Alias | NA |
Organism | Oryza sativa |
Position | chr12: 5766330-5766605 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os12g0210400 |
Parent gene annotation |
Protein kinase, core domain containing protein. (Os12t0210400-01 ) |
Parent gene strand | + |
Alternative splicing | Os12g0210400_circ_g.2 Os12g0210400_circ_g.3 Os12g0210400_circ_g.4 Os12g0210400_circ_g.5 Os12g0210400_circ_g.6 Os12g0210400_circ_g.7 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os12t0210400-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.129576993 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
5766398-5766419(+) 5766580-5766591(-) |
Potential amino acid sequence |
MWRQMDWDNLHREPGHIHKTVKFRTVRDAFRGHSVLIRIAVPLLDLTGLQVAGAAHHRIGLATI HVETNGLG*(+) MSPESVPDSPKLDSLMDVTRFPVQIIPIHLSPHGSLPAQFDGALPQLPASPLSPEEVLQF*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |