Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.009G315600_circ_g.1 |
| ID in PlantcircBase | gra_circ_001003 |
| Alias | Chr09:29774728|29776081 |
| Organism | Gossypium raimondii |
| Position | chrChr09: 29774728-29776081 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.009G315600 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | orai.009G315600_circ_g.2 |
| Support reads | 12 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.009G315600.2:3 Gorai.009G315600.1:4 Gorai.009G315600.3:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.120534373 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
29776018-29776075(-) |
| Potential amino acid sequence |
MATLGFEDYIEPLKIYLARYREGDTKGSARGGDGSFKRDAAGALPAQNPQFSIQGSLNYINSQG K*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |