Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d044878_circ_g.1 |
ID in PlantcircBase | zma_circ_009835 |
Alias | Zm09circ00004, zma_circ_0002882, ZmciR402 |
Organism | Zea mays |
Position | chr9: 6343484-6344402 JBrowse» |
Reference genome | AGPv4.38 |
Type | e-circRNA |
Identification method | CIRI2, find_circ |
Parent gene | Zm00001d044878 |
Parent gene annotation |
Chaperone protein dnaJ 1 mitochondrial |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, endosperm, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d044878_T001:3 Zm00001d044878_T002:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.101015597 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
6343651-6343698(+) 6343533-6344387(-) |
Potential amino acid sequence |
MYPFTSVCSSCRGIGKVIKDYCLTCQGSGVVGGMKHVTLDMPAGLDSGDTINVPEAGDSGGLGV QSGNLHIKIQVGEVTCQMQRYMFVPHVKDWEESLCIHSHPFVVRAEASGK*(+) MRDKHISLHLASDLSHLNFYV*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Han et al., 2020; Ma et al., 2021b;Zhang et al., 2019 |