Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G29030_circ_g.5 |
ID in PlantcircBase | ath_circ_004747 |
Alias | At_ciR4335 |
Organism | Arabidpsis thaliana |
Position | chr1: 10132444-10133077 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | find_circ, CIRI-full |
Parent gene | AT1G29030 |
Parent gene annotation |
Apoptosis inhibitory protein 5 (API5) |
Parent gene strand | - |
Alternative splicing | AT1G29030_circ_g.4 |
Support reads | 3 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT1G29030.1:3 AT1G29030.2:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.132496885 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
10132858-10132446(-) |
Potential amino acid sequence |
MSLFRQDTKASLTALFKHTEATLSTDEQIREKVLHFIRDKVRVQAIRGLPLFCKDTPDFISKII DVLVQCLNTEEFVERDAVHKALMSLFRQDTKASLTALFKHTEATLSTDEQIREKVLHFIRDKVR VQAIRGLPLFCKDTPDFISKIIDVLVQCLNTEEFVERDAVHKALMSLFRQDTKASLTALFKHTE ATLSTDEQIREKVLHFIRDKVRVQAIRGLPLFCKDTPDFISKIIDVLVQCLNTEEFVERDAVHK ALMSLFRQDTKASLTALFKHTEATLSTDEQIREKVLHFIRDK(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |