Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0633100_circ_g.2 |
| ID in PlantcircBase | osa_circ_034912 |
| Alias | Os07circ18112 |
| Organism | Oryza sativa |
| Position | chr7: 26260895-26262105 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, SMALT, Segemehl |
| Parent gene | Os07g0633100 |
| Parent gene annotation |
Similar to Glucan endo-1,3-beta-glucosidase 4. (Os07t0633100-01) ;Similar to Glucan endo-1,3-beta-glucosidase 4. (Os07t0633100-02 );Similar to Glucan endo-1,3-beta-glucosidase 4. (Os07t0633100-0 3);Similar to Glucan endo-1,3-beta-glucosidase 4. (Os07t0633100- 04);Similar to Glucan endo-1,3-beta-glucosidase 4. (Os07t0633100 -05) |
| Parent gene strand | - |
| Alternative splicing | Os07g0633100_circ_g.1 Os07g0633100_circ_g.3 Os07g0633100_circ_g.4 |
| Support reads | 2/3 |
| Tissues | leaf and panicle/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os07t0633100-05:2 Os07t0633100-03:2 Os07t0633100-01:2 Os07t0633100-04:2 Os07t0633100-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_007355* osi_circ_017384 |
| PMCS | 0.250517912 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
26262013-26260965(+) 26262045-26260927(+) 26262077-26261223(-) |
| Potential amino acid sequence |
MRLRGERRTEECCIFSIFWPTLYCSKNPPRALGSVAVVVAVPLKLQVAPAPELRW*(+) MLHLFNLLANIVLLQEPSKSTGVGGGGGGGAVEAAGGAGAGVALVVVVVGVGGQRRQVVRLVAR APRLDRRAVGVALAAGPVQPFLQRRRVRVRQRHAEHPRRQRPPLALALCRRGDLWTDRLGLAAA ALKKTPGCVCEEKGEQKNAASFQSFGQHCTAPRTLQEHWGRWRWWWRCR*(+) MLAKRLKRCSILLFAFLLADASGSLLESSGGQAEAIGPQISPATEGEGKRRSLATGMFCVALPN ADPTALQEGLNWACGQGHANCAAIQPGGPCYKANNLPALASYAYNDYYQRNSGAGATCSFNGTA TTTATDPSALGGFLEQYNVGQKIEKMQHSSVRLSPRRRIRESS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Chu et al., 2017 |