Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G30300_circ_g.4 |
| ID in PlantcircBase | ath_circ_024359 |
| Alias | At_ciR3305, AT3G30300_C1 |
| Organism | Arabidpsis thaliana |
| Position | chr3: 11922788-11923075 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, circRNA_finder, find_circ, CIRI2 |
| Parent gene | AT3G30300 |
| Parent gene annotation |
O-fucosyltransferase 27 |
| Parent gene strand | - |
| Alternative splicing | AT3G30300_circ_g.2 AT3G30300_circ_g.3 AT3G30300_circ_g.5 AT3G30300_circ_g.6 AT3G30300_circ_g.7 AT3G30300_circ_g.8 |
| Support reads | 2/6 |
| Tissues | leaf/root, aerial, inflorescences, seed, whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT3G30300.2:2 AT3G30300.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.424099528 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
11922836-11922790(-) |
| Potential amino acid sequence |
MTREALAYHGCAELFQAILPSDLEEYQRLRCRVAFHGLQFRKEVQELSTKVLQRLRPLGRPFIA YDPGMTREALAYHGCAELFQAILPSDLEEYQRLRCRVAFHGLQFRKEVQELSTKVLQRLRPLGR PFIAYDPGMTREALAYHGCAELFQAILPSDLEEYQRLRCRVAFHGLQFRKEVQELSTKVLQRLR PLGRPFIAYDPGMTREALAYHGCAELFQ(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017;Zhang et al., 2019 |