Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0390500_circ_g.6 |
| ID in PlantcircBase | osa_circ_006701 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr10: 12972365-12972675 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os10g0390500 |
| Parent gene annotation |
Alanine aminotransferase, Starch synthesis in developing seeds ( Os10t0390500-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os10t0390500-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.323824839 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
12972466-12972457(+) 12972401-12972457(+) |
| Potential amino acid sequence |
MFQYHWPDPCQPRHESTKGWRCIICFIQGRERWNPPIISSPCKGYYGECGKRGGYMEITGFSAP VREQIYKVASVNLCSNITGQILASLVMNPPKAGDASYASYKAEKDGILQSLARRAKDIMVNVAK EEATWRLLASVLQLESRSTKWRQ*(+) MEITGFSAPVREQIYKVASVNLCSNITGQILASLVMNPPKAGDASYASYKAEKDGILQSLARRA KDIMVNVAKEEATWRLLASVLQLESRSTKWRQ*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |