Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d008411_circ_g.1 |
ID in PlantcircBase | zma_circ_009538 |
Alias | zma_circ_0003006 |
Organism | Zea mays |
Position | chr8: 8047622-8048023 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d008411 |
Parent gene annotation |
Mediator of RNA polymerase II transcription subunit 17 |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d008411_T010:2 Zm00001d008411_T001:2 Zm00001d008411_T003:2 Zm00001d008411_T008:2 Zm00001d008411_T004:2 Zm00001d008411_T002:2 Zm00001d008411_T007:2 Zm00001d008411_T009:2 Zm00001d008411_T011:1 Zm00001d008411_T006:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.216358976 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
8047969-8047621(+) 8047786-8048021(-) 8047686-8048021(-) |
Potential amino acid sequence |
MKYWLTWQSLLPPSSSALGDTSNEEQRLAAIRRIDFSWVIEKDAKKAKKAAEADTAQQAWPWQG LMESLQQAHQELSVVIDLIGTVEANDAVAVASTTKPKSQPNEILVDMAVSAATKLQRLR*(+) MCLLQALHKALPGPCLLGSVSLSRLLGLLCILLYDPGEVNPADGRESLLLVASVT*(-) MTQEKSIRRMAASRCSSLLVSPKALELGGSRDCHVNQYFIWLRLGLRCRGDCHSVVSLNRADEV YDDRELLMCLLQALHKALPGPCLLGSVSLSRLLGLLCILLYDPGEVNPADGRESLLLVASVT*( -) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |