Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT5G02120_circ_g.1 |
ID in PlantcircBase | ath_circ_035969 |
Alias | Ath_circ_FC4839 |
Organism | Arabidpsis thaliana |
Position | chr5: 419357-419479 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT5G02120 |
Parent gene annotation |
Light-harvesting complex-like protein OHP1, chloroplastic |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 3 |
Tissues | whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT5G02120.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.339213956 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
419444-419476(+) |
Potential amino acid sequence |
MIGLIGTFIVELVIVPKAQPKSQPAFLGFTQTAEIWNSRACMIGLIGTFIVELVIVPKAQPKSQ PAFLGFTQTAEIWNSRACMIGLIGTFIVELVIVPKAQPKSQPAFLGFTQTAEIWNSRACMIGLI GTFIVEL(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017;Chen et al., 2017a |