Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT5G02120_circ_g.1 |
| ID in PlantcircBase | ath_circ_035969 |
| Alias | Ath_circ_FC4839 |
| Organism | Arabidpsis thaliana |
| Position | chr5: 419357-419479 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT5G02120 |
| Parent gene annotation |
Light-harvesting complex-like protein OHP1, chloroplastic |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 3 |
| Tissues | whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT5G02120.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.339213956 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
419444-419476(+) |
| Potential amino acid sequence |
MIGLIGTFIVELVIVPKAQPKSQPAFLGFTQTAEIWNSRACMIGLIGTFIVELVIVPKAQPKSQ PAFLGFTQTAEIWNSRACMIGLIGTFIVELVIVPKAQPKSQPAFLGFTQTAEIWNSRACMIGLI GTFIVEL(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017;Chen et al., 2017a |