Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os06g0618600_circ_g.7 |
ID in PlantcircBase | osa_circ_031392 |
Alias | NA |
Organism | Oryza sativa |
Position | chr6: 24836284-24836956 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os06g0618600 |
Parent gene annotation |
Rgp1 domain containing protein. (Os06t0618600-01) |
Parent gene strand | + |
Alternative splicing | Os06g0618600_circ_g.4 Os06g0618600_circ_g.5 Os06g0618600_circ_g.6 Os06g0618600_circ_g.8 Os06g0618600_circ_g.9 Os06g0618600_circ_g.10 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os06t0618600-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_016432 |
PMCS | 0.245575062 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
24836350-24836307(+) 24836339-24836947(-) |
Potential amino acid sequence |
MFSLDPDRSNDDAGPPLTPKYVEPAGSEGFMRGRSYNIRIDDQVLLRFSPKNSDSTYYFGDMIG GALTFFHGSGTRRCLEVSVTLETSETVNPRVIHPSRRSSPSITKVWCHLKGS*(+) MDDDLTANDLASFEVTPHLGY*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |