Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d034516_circ_g.2 |
| ID in PlantcircBase | zma_circ_006961 |
| Alias | Zm01circ00186, GRMZM2G029396_C1 |
| Organism | Zea mays |
| Position | chr1: 295475871-295476769 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | e-circRNA |
| Identification method | CIRI2 |
| Parent gene | Zm00001d034516 |
| Parent gene annotation |
Squalene synthase 1 |
| Parent gene strand | + |
| Alternative splicing | Zm00001d034516_circ_g.1 Zm00001d034516_circ_g.3 |
| Support reads | NA |
| Tissues | leaf, endosperm |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Zm00001d034516_T003:2 Zm00001d034516_T001:2 Zm00001d034516_T002:2 Zm00001d034516_T006:2 Zm00001d034516_T007:2 Zm00001d034516_T004:2 Zm00001d034516_T005:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.064443454 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
295475968-295475881(+) 295475947-295476745(-) |
| Potential amino acid sequence |
MSALKNHAIFHFCAIPQIMAIGTCALCYNNVHVFRGVVKMRRGFQI*(+) MNQCIRHYIVQALYCLFGIFLIFEIHVSSLQLL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | responsive to drought stress |
| Other Information | |
|---|---|
| References | Han et al., 2020;Zhang et al., 2019 |