Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d034516_circ_g.2 |
ID in PlantcircBase | zma_circ_006961 |
Alias | Zm01circ00186, GRMZM2G029396_C1 |
Organism | Zea mays |
Position | chr1: 295475871-295476769 JBrowse» |
Reference genome | AGPv4.38 |
Type | e-circRNA |
Identification method | CIRI2 |
Parent gene | Zm00001d034516 |
Parent gene annotation |
Squalene synthase 1 |
Parent gene strand | + |
Alternative splicing | Zm00001d034516_circ_g.1 Zm00001d034516_circ_g.3 |
Support reads | NA |
Tissues | leaf, endosperm |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d034516_T003:2 Zm00001d034516_T001:2 Zm00001d034516_T002:2 Zm00001d034516_T006:2 Zm00001d034516_T007:2 Zm00001d034516_T004:2 Zm00001d034516_T005:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.064443454 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
295475968-295475881(+) 295475947-295476745(-) |
Potential amino acid sequence |
MSALKNHAIFHFCAIPQIMAIGTCALCYNNVHVFRGVVKMRRGFQI*(+) MNQCIRHYIVQALYCLFGIFLIFEIHVSSLQLL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Han et al., 2020;Zhang et al., 2019 |