Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.011G158000_circ_g.1 |
| ID in PlantcircBase | gra_circ_001231 |
| Alias | Chr11:27944102|27944334 |
| Organism | Gossypium raimondii |
| Position | chrChr11: 27944102-27944334 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.011G158000 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 4 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.011G158000.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.457795959 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
27944105-27944105(+) 27944218-27944333(-) 27944184-27944308(-) |
| Potential amino acid sequence |
MTPAVIASVETMLDKWKDKEGEEIEAFQEFRILTSEVISRTAFGSSYFEGEKIFYMLQKLADIV SRNSNKSRIPILRT*(+) MTSEVKILNSWNASISSPSLSFHLSSIVSTLAITAGVMF*(-) MLRSLLLLCLSTCLALFQRWQLLLESCSEDWNPRLV*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |