Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0883900_circ_g.3 |
| ID in PlantcircBase | osa_circ_005099 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 38388022-38388776 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, circseq_cup |
| Parent gene | Os01g0883900 |
| Parent gene annotation |
Protein of unknown function DUF248, methyltransferase putative f amily protein. (Os01t0883900-01);Protein of unknown function DUF 248, methyltransferase putative family protein. (Os01t0883900-02 ) |
| Parent gene strand | - |
| Alternative splicing | Os01g0883900_circ_igg.1 Os01g0883900_circ_g.1 Os01g0883900_circ_g.2 Os01g0883900_circ_g.4 |
| Support reads | 3/3 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0883900-01:2 Os01t0883900-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.16340011 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
38388087-38388688(-) 38388773-38388688(-) |
| Potential amino acid sequence |
MRKDQKTAHRYARKLMMLMLHGGMLLLELNRLLRPGGYFVWSATPVYQKLPEDVEIWNAMSSLT KAMCWKMVNKTKDKLNQVGMAIYQKPMDNSCYEKRPENSPPLCKETDDADAAWWHAIAGTEPPI TPWWLLRLVCHSCLPEAP*(-) MLLLELNRLLRPGGYFVWSATPVYQKLPEDVEIWNAMSSLTKAMCWKMVNKTKDKLNQVGMAIY QKPMDNSCYEKRPENSPPLCKETDDADAAWWHAIAGTEPPITPWWLLRLVCHSCLPEAP*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2016;Chu et al., 2017 |