Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0438400_circ_g.8 |
| ID in PlantcircBase | osa_circ_039330 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr9: 16227390-16228175 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os09g0438400 |
| Parent gene annotation |
Similar to Choline/ethanolamine kinase. (Os09t0438400-00) |
| Parent gene strand | + |
| Alternative splicing | Os09g0438400_circ_g.2 Os09g0438400_circ_g.3 Os09g0438400_circ_g.4 Os09g0438400_circ_g.5 Os09g0438400_circ_g.6 Os09g0438400_circ_g.7 Os09g0438400_circ_g.9 Os09g0438400_circ_g.10 |
| Support reads | 1 |
| Tissues | shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os09t0438400-00:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_018520 |
| PMCS | 0.148800604 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
16227794-16227405(+) 16227787-16227747(+) |
| Potential amino acid sequence |
MIWKESSTSLISSMGRTATVVMILQTISMNMQAMIATIACIQIKILNTTSSGTIFNLIGQVSFD IGV*(+) MLNDLEGKLYFIDFEYGSYSYRGYDIANHFNEYAGYDCDYSLYPDKNSQYHFFRNYLQPDRPSE LRYWSLRIRRSRRDMKQSLLEKYKMKLKNLRICQTFCMLL*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |